PDB entry 1x6q

View 1x6q on RCSB PDB site
Description: Structure 3: cryocooled crystal structure of the truncated pak pilin from Pseudomonas aeruginosa at 1.51A resolution
Class: structural protein
Keywords: type IV pilin, lectin, adhesin, structural protein
Deposited on 2004-08-11, released 2005-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.139
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fimbrial protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PILA, FIMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02973 (7-122)
      • cloning artifact (3-6)
    Domains in SCOPe 2.06: d1x6qa2, d1x6qa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1x6qA (A:)
alegtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadank
lgtialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkg
csr

    Sequence, based on observed residues (ATOM records): (download) 
    >1x6qA (A:)
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr