PDB entry 1x6o

View 1x6o on RCSB PDB site
Description: structural analysis of leishmania braziliensis eukaryotic initiation factor 5a
Deposited on 2004-08-11, released 2004-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x6oA (A:)
    mahhhhhhmsdedhdfshqgggdnasktyplaagalkkggyvcingrpckvidlsvsktg
    khghakvsivatdiftgnrledqapsthnvevpfvktytysvldiqanedpslpahlslm
    ddegesredldmppdpalatqikeqfdsgkdvlvvvvsamgteqvlqtknaaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6oA (A:)
    ktyplaagalkkggyvcingrpckvidlsvskthakvsivatdiftgnrledqapsthnv
    evpfvktytysvldiqanedpslpahlslmddegesredldmppdpalatqikeqfdsgk
    dvlvvvvsamgteqvlqtknaae