PDB entry 1x6o

View 1x6o on RCSB PDB site
Description: Structural Analysis of Leishmania braziliensis eukaryotic initiation factor 5a
Class: translation
Keywords: SGPP, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, Structural Genomics of Pathogenic Protozoa Consortium, TRANSLATION
Deposited on 2004-08-11, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic initiation factor 5a
    Species: Leishmania braziliensis [TaxId:5660]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x6oa1, d1x6oa2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x6oA (A:)
    mahhhhhhmsdedhdfshqgggdnasktyplaagalkkggyvcingrpckvidlsvsktg
    khghakvsivatdiftgnrledqapsthnvevpfvktytysvldiqanedpslpahlslm
    ddegesredldmppdpalatqikeqfdsgkdvlvvvvsamgteqvlqtknaaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6oA (A:)
    ktyplaagalkkggyvcingrpckvidlsvskthakvsivatdiftgnrledqapsthnv
    evpfvktytysvldiqanedpslpahlslmddegesredldmppdpalatqikeqfdsgk
    dvlvvvvsamgteqvlqtknaae