PDB entry 1x6m

View 1x6m on RCSB PDB site
Description: Crystal structure of the glutathione-dependent formaldehyde-activating enzyme (Gfa)
Class: lyase
Keywords: zn-enzyme, formaldehyde, 3_10 helix, LYASE
Deposited on 2004-08-11, released 2004-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione-dependent formaldehyde-activating enzyme
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: gfa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51669 (3-195)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1x6ma1, d1x6ma2
  • Chain 'B':
    Compound: Glutathione-dependent formaldehyde-activating enzyme
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: gfa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51669 (3-195)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1x6mb1, d1x6mb2
  • Chain 'C':
    Compound: Glutathione-dependent formaldehyde-activating enzyme
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: gfa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51669 (3-195)
      • cloning artifact (2)
    Domains in SCOPe 2.06: d1x6mc1, d1x6mc2
  • Chain 'D':
    Compound: Glutathione-dependent formaldehyde-activating enzyme
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: gfa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51669 (3-195)
      • cloning artifact (2)
    Domains in SCOPe 2.06: d1x6md1, d1x6md2
  • Heterogens: ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x6mA (A:)
    ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
    kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
    gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
    daiathiakrsgalaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x6mB (B:)
    ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
    kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
    gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
    daiathiakrsgalaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x6mC (C:)
    ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
    kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
    gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
    daiathiakrsgalaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6mC (C:)
    mvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcwkp
    egaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfygl
    dfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplmda
    iathiakrsgalaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x6mD (D:)
    ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
    kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
    gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
    daiathiakrsgalaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6mD (D:)
    mvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcwkp
    egaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfygl
    dfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplmda
    iathiakrsgalaa