PDB entry 1x6l

View 1x6l on RCSB PDB site
Description: Crystal structure of S. marcescens chitinase A mutant W167A
Class: hydrolase
Keywords: Chitinase A, HYDROLASE
Deposited on 2004-08-11, released 2005-07-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase a
    Species: Serratia marcescens [TaxId:615]
    Gene: CHIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07254
      • see remark 999 (138)
      • see remark 999 (143)
      • engineered (166)
      • see remark 999 (225)
      • see remark 999 (394)
      • see remark 999 (436)
      • see remark 999 (472)
      • see remark 999 (483)
    Domains in SCOPe 2.04: d1x6la1, d1x6la2, d1x6la3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x6lA (A:)
    mrkfnkpllalligstlcsaaqaaapgkptiawgntkfaivevdqaataynnlvkvknaa
    dvsvswnlwngdagttakillngkeawsgpstgssgtanfkvnkggryqmqvalcnadgc
    tasdateivvadtdgshlpplkeslleknkpykqnsgkvvgsyfveagvygrnftvdkip
    aqnlthllygfipicggngindslkeiegsfqalqrscqgredfkisihdpfaalqkaqk
    gvtawddpykgnfgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkef
    lqtwkffdgvdidwefpggkganpnlgspqdgetyvllmkelramldqlsaetgrkyelt
    saisagkdkidkvaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtaytt
    vngvnallaqgvkpgkivvgtamygrgwtgvngyqnnipftgtatgpvkgtwengivdyr
    qiasqfmsgewqytydataeapyvfkpstgdlitfddarsvqakgkyvldkqlgglfswe
    idadngdilnsmnaslgnsagvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6lA (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdagttakillng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlpplke
    slleknkpykqnsgkvvgsyfveagvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkisihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwefpggkgan
    pnlgspqdgetyvllmkelramldqlsaetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiasqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagv