PDB entry 1x6k

View 1x6k on RCSB PDB site
Description: the solution structure of the nucleotide binding domain of kdpb
Class: hydrolase
Keywords: alpha-beta sandwich
Deposited on 2004-08-11, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-12-20, with a file datestamp of 2007-04-25.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium-transporting ATPase B chain
    Species: Escherichia coli
    Gene: kdpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x6ka_
  • Heterogens: ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x6kA (A:)
    mghhhhhhhhhhssghggrhnrqasefipaqgvdektladaaqlasladetpegrsivil
    akqrfnlrerdvqslhatfvpftaqsrmsginidnrmirkgsvdairrhveangghfptd
    vdqkvdqvarqgatplvvvegsrvlgvialkdivkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6kA (A:)
    nrqasefipaqgvdektladaaqlasladetpegrsivilakqrfnlrerdvqslhatfv
    pftaqsrmsginidnrmirkgsvdairrhveangghfptdvdqkvdqvarqgatplvvve
    gsrvlgvialkdivkg