PDB entry 1x6j

View 1x6j on RCSB PDB site
Description: Crystal structure of ygfY from Escherichia coli
Class: structural genomics, unknown function
Keywords: structural genomics, ygfY, hypothetical protein, transcriptional regulation, Structure 2 Function Project, S2F, UNKNOWN FUNCTION
Deposited on 2004-08-11, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein ygfY
  Species: Escherichia coli [TaxId:562]
  Gene: ygfY
  Database cross-references and differences (RAF-indexed):
  • Uniprot P64559 (3-90)
  Domains in SCOPe 2.08: d1x6ja_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1x6jA (A:)
  gshmdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnw
  lmnhgkpadaelemmvrliqtrnrergpvai
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1x6jA (A:)
  mdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmn
  hgkpadaelemmvrliqtrnrergpvai