PDB entry 1x6i

View 1x6i on RCSB PDB site
Description: Crystal structure of ygfY from Escherichia coli
Class: structural genomics, unknown function
Keywords: structural genomics, ygfY, hypothetical protein, transcriptional regulation, Structure 2 Function Project, S2F, UNKNOWN FUNCTION
Deposited on 2004-08-11, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.171
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ygfY
    Species: Escherichia coli [TaxId:562]
    Gene: ygfY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64559
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1x6ia1, d1x6ia2
  • Chain 'B':
    Compound: Hypothetical protein ygfY
    Species: Escherichia coli [TaxId:562]
    Gene: ygfY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x6ib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x6iA (A:)
    gshmdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnw
    lmnhgkpadaelemmvrliqtrnrergpvai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6iA (A:)
    hmdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlm
    nhgkpadaelemmvrliqtrnrergpvai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x6iB (B:)
    gshmdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnw
    lmnhgkpadaelemmvrliqtrnrergpvai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x6iB (B:)
    mdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmn
    hgkpadaelemmvrliqtrnrergpva