PDB entry 1x6h

View 1x6h on RCSB PDB site
Description: Solution structures of the C2H2 type zinc finger domain of human Transcriptional repressor CTCF
Class: DNA binding protein
Keywords: zinc finger protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional repressor CTCF
    Species: Homo sapiens [TaxId:9606]
    Gene: Ctcf
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49711 (7-79)
      • cloning artifact (0-6)
      • cloning artifact (80-85)
    Domains in SCOPe 2.03: d1x6ha1, d1x6ha2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x6hA (A:)
    gssgssgrthtgekpyacshcdktfrqkqlldmhfkryhdpnfvpaafvcskcgktftrr
    ntmarhadncagpdgvegensgpssg