PDB entry 1x6g

View 1x6g on RCSB PDB site
Description: Solution structures of the SH3 domain of human megakaryocyte-associated tyrosine-protein kinase.
Class: signaling protein
Keywords: MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Megakaryocyte-associated tyrosine-protein kinase
  Species: Homo sapiens [TaxId:9606]
  Gene: MATK
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42679 (7-74)
    • cloning artifact (0-6)
    • cloning artifact (75-80)
  Domains in SCOPe 2.08: d1x6ga1, d1x6ga2, d1x6ga3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x6gA (A:)
  gssgssgrmptrrwapgtqcitkcehtrpkpgelafrkgdvvtileacenkswyrvkhht
  sgqegllaagalrersgpssg