PDB entry 1x6f

View 1x6f on RCSB PDB site
Description: Solution structures of the C2H2 type zinc finger domain of human Zinc finger protein 462
Class: DNA binding protein
Keywords: zinc finger domain, KIAA1803, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 462
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF462
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96JM2 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)
    Domains in SCOPe 2.03: d1x6fa1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x6fA (A:)
    gssgssglkrdfiilgngprlqnstyqckhcdsklqstaeltshlnihneefqkrakrqe
    rrkqllskqkyadgafadfkqesgpssg