PDB entry 1x6d

View 1x6d on RCSB PDB site
Description: Solution structures of the PDZ domain of human Interleukin-16
Class: signaling protein
Keywords: PDZ domain, Lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Interleukin-16
  Species: HOMO SAPIENS
  Gene: IL16
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14005 (7-112)
    • cloning artifact (0-6)
    • cloning artifact (113-118)
  Domains in SCOP 1.73: d1x6da1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x6dA (A:)
  gssgssgatlkqldgihvtilhkeegaglgfslaggadlenkvitvhrvfpnglasqegt
  iqkgnevlsingkslkgtthhdalailrqareprqavivtrkltpeampdlnssgpssg