PDB entry 1x6d

View 1x6d on RCSB PDB site
Description: Solution structures of the PDZ domain of human Interleukin-16
Class: signaling protein
Keywords: PDZ domain, Lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-16
    Species: Homo sapiens [TaxId:9606]
    Gene: IL16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14005 (7-112)
      • cloning artifact (0-6)
      • cloning artifact (113-118)
    Domains in SCOPe 2.08: d1x6da1, d1x6da2, d1x6da3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x6dA (A:)
    gssgssgatlkqldgihvtilhkeegaglgfslaggadlenkvitvhrvfpnglasqegt
    iqkgnevlsingkslkgtthhdalailrqareprqavivtrkltpeampdlnssgpssg