PDB entry 1x6c

View 1x6c on RCSB PDB site
Description: Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1
Deposited on 2005-05-17, released 2005-11-17
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase, non-receptor type 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29350 (7-111)
      • cloning artifact (0-6)
      • cloning artifact (112-117)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x6cA (A:)
    gssgssgwyhghmsggqaetllqakgepwtflvreslsqpgdfvlsvlsdqpkagpgspl
    rvthikvmceggrytvggletfdsltdlvehfkktgieeasgafvylrqpyysgpssg