PDB entry 1x6b

View 1x6b on RCSB PDB site
Description: Solution structures of the SH3 domain of human rho guanine exchange factor (GEF) 16
Deposited on 2005-05-17, released 2005-11-17
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine exchange factor (GEF) 16
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99434 (7-72)
      • cloning artifact (0-6)
      • cloning artifact (73-78)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x6bA (A:)
    gssgssgwqglsskgdlpqveitkaffakqadevtlqqadvvlvlqqedgwlygerlrdg
    etgwfpedfarfisgpssg