PDB entry 1x6a

View 1x6a on RCSB PDB site
Description: Solution structures of the second LIM domain of human LIM-kinase 2 (LIMK2)
Class: protein binding
Keywords: LIM-kinase 2, zinc finger domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: LIM domain kinase 2
  Species: Homo sapiens [TaxId:9606]
  Gene: LIMK2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P53671 (7-74)
    • cloning artifact (0-6)
    • cloning artifact (75-80)
  Domains in SCOPe 2.07: d1x6aa1, d1x6aa2, d1x6aa3, d1x6aa4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x6aA (A:)
  gssgssgkdywgkfgefchgcsllmtgpfmvagefkyhpecfacmsckviiedgdayalv
  qhatlycgkchnevvsgpssg