PDB entry 1x69

View 1x69 on RCSB PDB site
Description: Solution structures of the SH3 domain of human Src substrate cortactin
Class: signaling protein
Keywords: SH3 domain, CTTN, Oncogene EMS1, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cortactin isoform a
    Species: Homo sapiens [TaxId:9606]
    Gene: EMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14247 (7-72)
      • cloning artifact (0-6)
      • cloning artifact (73-78)
    Domains in SCOPe 2.08: d1x69a1, d1x69a2, d1x69a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x69A (A:)
    gssgssgtydeyendlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgr
    yglfpanyvelrqsgpssg