PDB entry 1x68

View 1x68 on RCSB PDB site
Description: Solution structures of the C-terminal LIM domain of human FHL5 protein
Class: protein binding
Keywords: four-and-a-half LIM protein 5, zinc finger domain, an actin-interacting protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FHL5 protein
    Species: HOMO SAPIENS
    Gene: FHL5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TD97 (7-69)
      • cloning artifact (0-6)
      • cloning artifact (70-75)
    Domains in SCOP 1.75: d1x68a1, d1x68a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x68A (A:)
gssgssgcvacskpisgltgakficfqdsqwhsecfncgkcsvslvgkgfltqnkeifcq
kcgsgmdtdisgpssg