PDB entry 1x67

View 1x67 on RCSB PDB site
Description: Solution structure of the cofilin homology domain of HIP-55 (drebrin-like protein)
Deposited on 2005-05-17, released 2005-11-17
The last revision was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Drebrin-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DBNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJU6 (7-139)
      • cloning artifact (0-6)
      • cloning artifact (140-145)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x67A (A:)
    gssgssgmaanlsrngpalqeayvrvvteksptdwalftyegnsndirvagtgeggleem
    veelnsgkvmyafcrvkdpnsglpkfvlinwtgegvndvrkgacashvstmasflkgahv
    tinaraeedvepecimekvasgpssg