PDB entry 1x66

View 1x66 on RCSB PDB site
Description: Solution structure of the SAM_PNT-domain of the human friend LEUKEMIAINTEGRATION 1 transcription factor
Class: signaling protein
Keywords: Cell-free protein synthesis, protein regulation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Friend leukemia integration 1 transcription factor
    Species: Homo sapiens [TaxId:9606]
    Gene: FLI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01543 (7-91)
      • cloning artifact (0-6)
      • cloning artifact (92-97)
    Domains in SCOPe 2.07: d1x66a1, d1x66a2, d1x66a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x66A (A:)
    gssgssgppnmttnerrvivpadptlwtqehvrqwlewaikeyslmeidtsffqnmdgke
    lckmnkedflrattlyntevllshlsylresssgpssg