PDB entry 1x65

View 1x65 on RCSB PDB site
Description: solution structure of the third cold-shock domain of the human kiaa0885 protein (unr protein)
Deposited on 2005-05-17, released 2005-11-17
The last revision was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UNR protein
    Species: Homo sapiens [TaxId:9606]
    Gene: UNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75534 (7-82)
      • cloning artifact (0-6)
      • cloning artifact (83-88)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x65A (A:)
    gssgssgremgviaamrdgfgfikcvdrdvrmffhfseildgnqlhiadeveftvvpdml
    saqrnhairikklpkgtvsfhshsgpssg