PDB entry 1x64

View 1x64 on RCSB PDB site
Description: Solution structure of the LIM domain of alpha-actinin-2 associated LIM protein
Class: Contractile protein
Keywords: LIM domain, Alpha-actinin-2 associated LIM protein, PDZ and LIM domain 3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Contractile protein
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-actinin-2 associated LIM protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 6720456D19
  Database cross-references and differences (RAF-indexed):
  • Uniprot O70209 (7-82)
    • cloning artifact (0-6)
    • cloning artifact (83-88)
  Domains in SCOPe 2.08: d1x64a1, d1x64a2, d1x64a3, d1x64a4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x64A (A:)
  gssgssgvrapvtkvhggagsaqrmplcdkcgsgivgavvkardkyrhpecfvcadcnln
  lkqkgyffvegelycetharartsgpssg