PDB entry 1x63

View 1x63 on RCSB PDB site
Description: Solution structure of the second LIM domain of skeletal muscle LIM protein 1
Class: Contractile protein
Keywords: LIM domain, Skeletal muscle LIM-protein 1, Four and a half LIM domains protein 1 , Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Skeletal muscle LIM-protein 1
    Species: HOMO SAPIENS
    Gene: FHL1, SLIM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13642 (7-75)
      • cloning artifact (0-6)
      • cloning artifact (76-81)
    Domains in SCOP 1.73: d1x63a1, d1x63a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x63A (A:)
    gssgssgkcttredspkckgcfkaivagdqnveykgtvwhkdcftcsnckqvigtgsffp
    kgedfycvtchetkfasgpssg