PDB entry 1x63

View 1x63 on RCSB PDB site
Description: Solution structure of the second LIM domain of skeletal muscle LIM protein 1
Class: Contractile protein
Keywords: LIM domain, Skeletal muscle LIM-protein 1, Four and a half LIM domains protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Contractile protein
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Skeletal muscle LIM-protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FHL1, SLIM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13642 (7-75)
      • cloning artifact (0-6)
      • cloning artifact (76-81)
    Domains in SCOPe 2.08: d1x63a1, d1x63a2, d1x63a3, d1x63a4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x63A (A:)
gssgssgkcttredspkckgcfkaivagdqnveykgtvwhkdcftcsnckqvigtgsffp
kgedfycvtchetkfasgpssg