PDB entry 1x62

View 1x62 on RCSB PDB site
Description: Solution structure of the LIM domain of carboxyl terminal LIM domain protein 1
Class: Structural protein
Keywords: LIM domain, PDZ and LIM domain protein 1, LIM domain protein CLP-36, C-terminal LIM domain protein 1, contractile protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-terminal LIM domain protein 1
    Species: HOMO SAPIENS
    Gene: PDLIM1, CLIM1, CLP36
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00151 (7-72)
      • cloning artifact (0-6)
      • cloning artifact (73-78)
    Domains in SCOP 1.73: d1x62a1, d1x62a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x62A (A:)
gssgssgsignaqklpmcdkcgtgivgvfvklrdrhrhpecyvctdcgtnlkqkghffve
dqiycekharervsgpssg