PDB entry 1x60

View 1x60 on RCSB PDB site
Description: Solution structure of the peptidoglycan binding domain of B. subtilis cell wall lytic enzyme CwlC
Class: Hydrolase
Keywords: CwlC, CwlCr, peptidoglycan, cell wall lytic amidase, tandem repeats, Hydrolase
Deposited on 2005-05-17, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sporulation-specific N-acetylmuramoyl-L-alanine amidase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x60a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x60A (A:)
    lkktsssglykvqigafkvkanadslasnaeakgfdsivllkdglykvqigafsskdnad
    tlaaraknagfdaiviles