PDB entry 1x5y

View 1x5y on RCSB PDB site
Description: Solution structure of the fibronectin type-III domain of mouse myosin-binding protein C, Fast-type homolog
Class: cell adhesion
Keywords: Fast MyBP-C, Fibronectin type III domain containing protein, Cytoskeleton, Muscle contraction, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: myosin binding protein C, fast-type
  Species: Mus musculus [TaxId:10090]
  Gene: Mybpc2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5XKE0 (7-104)
    • cloning artifact (0-6)
    • cloning artifact (105-110)
  Domains in SCOPe 2.08: d1x5ya1, d1x5ya2, d1x5ya3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x5yA (A:)
  gssgssgptsapqhltvedvtdttttlkwrppdrigaggidgylveyclegseewvpank
  epvercgftvkdlptgarilfrvvgvniagrsepatllqpvtiresgpssg