PDB entry 1x5w

View 1x5w on RCSB PDB site
Description: Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 64, isoforms 1 and 2
Class: transcription
Keywords: Zinc finger protein 338, ZNF338, Nuclear protein, DNA binding, Transcription, C2H2 type zinc finger, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger protein 64, isoforms 1
  Species: Homo sapiens [TaxId:9606]
  Gene: ZFP64
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NPA5 (7-63)
    • cloning artifact (0-6)
    • cloning artifact (64-69)
  Domains in SCOPe 2.03: d1x5wa1, d1x5wa2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x5wA (A:)
  gssgssghpekcsecsyscsskaalriherihctdrpfkcnycsfdtkqpsnlskhmkkf
  hgdmsgpssg