PDB entry 1x5u

View 1x5u on RCSB PDB site
Description: solution structure of rrm domain in splicing factor 3b
Deposited on 2005-05-16, released 2005-11-16
Made obsolete by 5gvq on 2017-04-12

The last revision was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit).
  Species: Homo sapiens [TaxId:9606]
  Gene: SF3B4, SAP49
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15427 (7-98)
    • cloning artifact (0-6)
    • engineered (77)
    • cloning artifact (99-104)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >1x5uA (A:)
  gssgssgpisernqdatvyvggldekvsepllwelflqagpvvnthmpkdrvtgqhqgyg
  fveflseedadyaikimdmiklygkpirvnkasahnknlsgpssg