PDB entry 1x5s

View 1x5s on RCSB PDB site
Description: Solution structure of RRM domain in A18 hnRNP
Class: RNA binding protein
Keywords: NMR, structure genomics, RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-16, released 2005-11-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold-inducible RNA-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CIRBP, A18HNRNP, CIRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14011 (7-95)
      • cloning artifact (0-6)
      • cloning artifact (96-101)
    Domains in SCOPe 2.03: d1x5sa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5sA (A:)
    gssgssgmasdegklfvgglsfdtneqsleqvfskygqisevvvvkdretqrsrgfgfvt
    feniddakdammamngksvdgrqirvdqagkssdnrsgpssg