PDB entry 1x5q

View 1x5q on RCSB PDB site
Description: Solution structure of the first PDZ domain of scribble homolog protein (hScrib)
Class: cell adhesion, cell cycle
Keywords: PDZ domain, LAP4 protein, Scribble homolog protein, hScrib, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION, CELL CYCLE
Deposited on 2005-05-16, released 2005-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LAP4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SCRIB, CRIB1, KIAA0147, LAP4, SCRB1, VARTUL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14160 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)
    Domains in SCOPe 2.07: d1x5qa1, d1x5qa2, d1x5qa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5qA (A:)
    gssgssgeparieeeeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaa
    ragvrvgdkllevngvalqgaehheavealrgagtavqmrvwresgpssg