PDB entry 1x5p

View 1x5p on RCSB PDB site
Description: Solution structure of RRM domain in Parp14
Class: RNA binding protein
Keywords: NMR, structure genomics, RRM domain, Parp14, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-16, released 2005-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: negative elongation factor e
  Species: Homo sapiens [TaxId:9606]
  Gene: RDBP, NELFE, RD
  Database cross-references and differences (RAF-indexed):
  • Uniprot P18615 (7-90)
    • cloning artifact (0-6)
    • cloning artifact (91-96)
  Domains in SCOPe 2.06: d1x5pa1, d1x5pa2, d1x5pa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x5pA (A:)
  gssgssgerraprkgntlyvygedmtptllrgafspfgniidlsmdpprncafvtyekme
  sadqavaelngtqvesvqlkvniarkqpmldsgpssg