PDB entry 1x5n

View 1x5n on RCSB PDB site
Description: Solution structure of the second PDZ domain of harmonin protein
Class: structural protein
Keywords: PDZ domain, Harmonin, Usher syndrome 1C protein, Autoimmune enteropathy-related antigen AIE-75 ,Antigen NY-CO-38/NY-CO-37, PDZ-73 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2005-05-16, released 2005-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Harmonin
    Species: Homo sapiens [TaxId:9606]
    Gene: USH1C; AIE75
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6N9 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
    Domains in SCOPe 2.06: d1x5na1, d1x5na2, d1x5na3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5nA (A:)
    gssgssgspgnrenkekkvfislvgsrglgcsissgpiqkpgifishvkpgslsaevgle
    igdqivevngvdfsnldhkeavnvlkssrsltisivaaagrelfmtdrsgpssg