PDB entry 1x5m

View 1x5m on RCSB PDB site
Description: Solution structure of the core domain of calcyclin binding protein; siah-interacting protein (SIP)
Deposited on 2005-05-16, released 2005-11-16
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcyclin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CACYBP, S100A6BP, SIP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HB71 (7-120)
      • cloning artifact (0-6)
      • cloning artifact (121-126)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x5mA (A:)
    gssgssgvvapittgytvkisnygwdqsdkfvkiyitltgvhqvptenvqvhftersfdl
    lvknlngksysmivnnllkpisvegsskkvktdtvlilcrkkventrwdyltqvekecke
    ksgpssg