PDB entry 1x5l

View 1x5l on RCSB PDB site
Description: Solution structure of the second fn3 domain of Eph receptor A8 protein
Class: Signaling protein
Keywords: fn3 domain, Ephrin type-A receptor 8 precursor/Tyrosine-protein kinase receptor EEK, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Signaling protein
Deposited on 2005-05-16, released 2005-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ephrin type-a receptor 8
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA fh16961
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29322 (7-104)
    • cloning artifact (0-6)
    • cloning artifact (105-110)
  Domains in SCOPe 2.07: d1x5la1, d1x5la2, d1x5la3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x5lA (A:)
  gssgssgqaapsqvvvirqeragqtsvsllwqepeqpngiileyeikyyekdkemqsyst
  lkavttratvsglkpgtryvfqvrartsagcgrfsqamevetgkpsgpssg