PDB entry 1x5i

View 1x5i on RCSB PDB site
Description: The solution structure of the fourth fibronectin type III domain of human Neogenin
Class: cell adhesion
Keywords: RGM binding, fibronectin type III domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-15, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neogenin
  Species: HOMO SAPIENS
  Gene: NEO1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92859 (7-119)
    • cloning artifact (0-6)
    • cloning artifact (120-125)
  Domains in SCOP 1.75: d1x5ia1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x5iA (A:)
  gssgssgpatdwlsaetfesdldetrvpevpsslhvrplvtsivvswtppenqnivvrgy
  aigygigsphaqtikvdykqryytienldpsshyvitlkafnnvgegiplyesavtrpht
  sgpssg