PDB entry 1x5e

View 1x5e on RCSB PDB site
Description: The solution structure of the thioredoxin-like domain of human Thioredoxin-related transmembrane protein
Class: electron transport
Keywords: TMX, thioredoxin, TXNDC1, redox, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ELECTRON TRANSPORT
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin domain containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TXNDC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3N1 (7-119)
      • cloning artifact (0-6)
      • cloning artifact (120-125)
    Domains in SCOPe 2.07: d1x5ea1, d1x5ea2, d1x5ea3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5eA (A:)
    gssgssgnvrvitdenwrellegdwmiefyapwcpacqnlqpewesfaewgedlevniak
    vdvteqpglsgrfiinalptiyhckdgefrryqgprtkkdfinfisdkewksiepvsswf
    sgpssg