PDB entry 1x5d

View 1x5d on RCSB PDB site
Description: The solution structure of the second thioredoxin-like domain of human Protein disulfide-isomerase A6
Class: isomerase
Keywords: PDIA6, ERP5, P5, TXNDC7, Thioredoxin like domain, redox, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ISOMERASE
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein disulfide-isomerase A6
    Species: Homo sapiens [TaxId:9606]
    Gene: Pdia6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15084 (7-126)
      • cloning artifact (0-6)
      • cloning artifact (127-132)
    Domains in SCOPe 2.07: d1x5da1, d1x5da2, d1x5da3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5dA (A:)
    gssgssgdvieltddsfdknvldsedvwmvefyapwcghcknlepewaaaasevkeqtkg
    kvklaavdatvnqvlasrygirgfptikifqkgespvdydggrtrsdivsraldlfsdna
    pppellesgpssg