PDB entry 1x5c

View 1x5c on RCSB PDB site
Description: The solution structure of the second thioredoxin-like domain of human Protein disulfide-isomerase
Class: isomerase
Keywords: DSI, ERBA2L, GIT, PDI, PDIA1, PO4DB, PO4HB, PROHB, thioredoxin like domain, redox, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ISOMERASE
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein disulfide-isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: P4HB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07237 (7-114)
      • cloning artifact (0-6)
      • cloning artifact (115-120)
    Domains in SCOPe 2.07: d1x5ca1, d1x5ca2, d1x5ca3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5cA (A:)
    gssgssgpvkvlvgknfedvafdekknvfvefyapwcghckqlapiwdklgetykdheni
    viakmdstaneveavkvhsfptlkffpasadrtvidyngertldgfkkflesggqsgpss
    g