PDB entry 1x5b

View 1x5b on RCSB PDB site
Description: The solution structure of the VHS domain of human Signal transducing adaptor molecule 2
Class: protein binding
Keywords: VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal transducing adaptor molecule 2
    Species: Homo sapiens [TaxId:9606]
    Gene: STAM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75886 (7-156)
      • cloning artifact (0-6)
      • cloning artifact (157-162)
    Domains in SCOPe 2.07: d1x5ba1, d1x5ba2, d1x5ba3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x5bA (A:)
    gssgssgmplftanpfeqdvekatneynttedwslimdicdkvgstpngakdclkaimkr
    vnhkvphvalqaltllgacvancgkifhlevcsrdfatevraviknkahpkvceklkslm
    vewseefqkdpqfslisatiksmkeegitfppagsqtsgpssg