PDB entry 1x5a

View 1x5a on RCSB PDB site
Description: The solution structure of the second fibronectin type III domain of mouse Ephrin type-A receptor 1
Class: structural genomics, unknown function
Keywords: Tyrosine-protein kinase receptor, ESK, fibronectin type III (fn3) domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ephrin type-A receptor 1
  Species: Mus musculus [TaxId:10090]
  Gene: Epha1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60750 (7-100)
    • cloning artifact (0-6)
    • cloning artifact (101-106)
  Domains in SCOPe 2.08: d1x5aa1, d1x5aa2, d1x5aa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x5aA (A:)
  gssgssgaeslsglslklvkkeprqleltwagsrprnpggnlsyelhvlnqdeewhqmvl
  eprvlltklqpdttyivrvrtltplgpgpfspdhefrtsppsgpssg