PDB entry 1x59

View 1x59 on RCSB PDB site
Description: Solution structures of the WHEP-TRS domain of human histidyl-tRNA synthetase
Deposited on 2005-05-15, released 2005-11-15
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: HARS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12081 (7-66)
      • cloning artifact (0-6)
      • cloning artifact (67-72)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x59A (A:)
    gssgssgmaeraaleelvklqgervrglkqqkasaelieeevakllklkaqlgpdeskqk
    fvlktpksgpssg