PDB entry 1x57

View 1x57 on RCSB PDB site
Description: Solution structures of the HTH domain of human EDF-1 protein
Class: DNA binding protein
Keywords: EDF1, HMBF1alpha, helix-turn-helix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial differentiation-related factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EDF-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60869 (7-84)
      • cloning artifact (0-6)
      • cloning artifact (85-90)
    Domains in SCOPe 2.08: d1x57a1, d1x57a2, d1x57a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x57A (A:)
gssgssgdrvtlevgkviqqgrqskgltqkdlatkinekpqviadyesgraipnnqvlgk
ieraiglklrgkdigkpiekgpraksgpssg