PDB entry 1x56

View 1x56 on RCSB PDB site
Description: Crystal structure of asparaginyl-tRNA synthetase from Pyrococcus horikoshii
Class: ligase
Keywords: aminoacyl-trna synthetase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE
Deposited on 2005-05-15, released 2006-05-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Asparaginyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1x56a1, d1x56a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x56A (A:)
    miekvycqevkpeldgkkvrlagwvytnmrvgkkiflwirdstgivqavvaknvvgeetf
    ekakklgressvivegivkaderapggaevhvekleviqavsefpipenpeqaspellld
    yrhlhirtpkasaimkvketlimaarewllkdgwhevfppilvtgaveggatlfklkyfd
    kyaylsqsaqlyleaaifglekvwsltpsfraeksrtrrhltefwhleleaawmdlwdim
    kveeelvsymvqrtlelrkkeiemfrddlttlknteppfprisydeaidilqskgvnvew
    gddlgadeervlteefdrpffvygypkhikafymkedpndprkvlasdmlapegygeiig
    gsqreddydkllnrileegmdpkdyewyldlrrygsvphsgfglgverlvawvlkldhir
    waalfprtparlyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x56A (A:)
    miekvycqevkpeldgkkvrlagwvytnmrvgkkiflwirdstgivqavvaknvvgeetf
    ekakklgressvivegivkaderapggaevhvekleviqavsefpipenpeqaspellld
    yrhlhirtpkasaimkvketlimaarewllkdgwhevfppilvtlfklkyfdkyaylsqs
    aqlyleaaifglekvwsltpsfraehltefwhleleaawmdlwdimkveeelvsymvqrt
    lelrkkeiemfrddlttlknteppfprisydeaidilqskgvnvewgddlgadeervlte
    efdrpffvygypkhikafymkedpndprkvlasdmlapegygeiiggsqreddydkllnr
    ileegmdpkdyewyldlrrygsvphsgfglgverlvawvlkldhirwaalfprtparlyp