PDB entry 1x53

View 1x53 on RCSB PDB site
Description: The solution structure of the C-terminal domain of human Activator of 90 kDa heat shock protein ATPase homolog 1
Class: structural genomics, unknown function
Keywords: AHA1, Hsp90,DUF704, C-terminal domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-15, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Activator of 90 kDa heat shock protein ATPase homolog 1
  Species: HOMO SAPIENS
  Gene: AHSA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95433 (7-138)
    • cloning artifact (0-6)
    • cloning artifact (139-144)
  Domains in SCOP 1.73: d1x53a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x53A (A:)
  gssgssgiptckitlketfltspeelyrvfttqelvqafthapatleadrggkfhmvdgn
  vsgeftdlvpekhivmkwrfkswpeghfatitltfidkngetelcmegrgipapeeertr
  qgwqryyfegikqtfgygasgpssg