PDB entry 1x53

View 1x53 on RCSB PDB site
Description: The solution structure of the C-terminal domain of human Activator of 90 kDa heat shock protein ATPase homolog 1
Class: structural genomics, unknown function
Keywords: AHA1, Hsp90,DUF704, C-terminal domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Activator of 90 kDa heat shock protein ATPase homolog 1
  Species: Homo sapiens [TaxId:9606]
  Gene: AHSA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95433 (7-138)
    • cloning artifact (0-6)
    • cloning artifact (139-144)
  Domains in SCOPe 2.08: d1x53a1, d1x53a2, d1x53a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x53A (A:)
  gssgssgiptckitlketfltspeelyrvfttqelvqafthapatleadrggkfhmvdgn
  vsgeftdlvpekhivmkwrfkswpeghfatitltfidkngetelcmegrgipapeeertr
  qgwqryyfegikqtfgygasgpssg