PDB entry 1x51

View 1x51 on RCSB PDB site
Description: Solution structure of the NUDIX domain from human A/G-specific adenine DNA glycosylase alpha-3 splice isoform
Class: hydrolase, DNA binding protein
Keywords: NUDIX domain, DNA repair, alpha-3 isoform, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE, DNA BINDING PROTEIN
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A/G-specific adenine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: MUTYH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF7 (7-148)
      • cloning artifact (0-6)
      • cloning artifact (149-154)
    Domains in SCOPe 2.08: d1x51a1, d1x51a2, d1x51a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x51A (A:)
    gssgssgprkasrkppreessatcvleqpgalgaqillvqrpnsgllaglwefpsvtwep
    seqlqrkallqelqrwagplpathlrhlgevvhtfshikltyqvyglalegqtpvttvpp
    garwltqeefhtaavstamkkvfrvyqgqsgpssg