PDB entry 1x4y

View 1x4y on RCSB PDB site
Description: Solution structure of the 3rd fibronectin type III domain from mouse biregional cell adhesion molecule-related/down-regulated oncogenes (Cdon) binding protein
Class: cell adhesion
Keywords: fibronectin type III, fn3, immunoglobulin-like beta-sandwich fold, cell adhesion, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-15, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: biregional cell adhesion molecule-related/down-regulated oncogenes (Cdon)binding protein
  Species: Mus musculus [TaxId:10090]
  Gene: Boc
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7TMJ3 (7-107)
    • cloning artifact (0-6)
    • cloning artifact (108-113)
  Domains in SCOPe 2.08: d1x4ya1, d1x4ya2, d1x4ya3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x4yA (A:)
  gssgssgpvagpyitftdavnettimlkwmyipasnnntpihgfyiyyrptdsdndsdyk
  kdmvegdrywhsishlqpetsydikmqcfneggesefsnvmicetkarsgpssg