PDB entry 1x4u

View 1x4u on RCSB PDB site
Description: Solution structure of the FYVE domain from human FYVE domain containing 27 isoform b protein
Deposited on 2005-05-15, released 2005-11-15
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger, FYVE domain containing 27 isoform b
    Species: Homo sapiens [TaxId:9606]
    Gene: ZFYVE27
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T4F4 (7-77)
      • cloning artifact (0-6)
      • cloning artifact (78-83)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x4uA (A:)
    gssgssgryptnnfgnctgcsatfsvlkkrrscsncgnsfcsrccsfkvpkssmgatape
    aqretvfvcascnqtlsksgpssg