PDB entry 1x4t

View 1x4t on RCSB PDB site
Description: Solution structure of Isy1 domain in hypothetical protein
Class: RNA binding protein
Keywords: NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein LOC57905
  Species: MUS MUSCULUS
  Gene: 5830446M03Rik
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D3E2 (7-85)
    • cloning artifact (0-6)
    • cloning artifact (86-91)
  Domains in SCOP 1.73: d1x4ta1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x4tA (A:)
  gssgssgkvkerrpflasectelpkaekwrrqiigeiskkvaqiqnaglgefrirdlnde
  inkllrekghwevrikelggpdygkvsgpssg